Petco Text Logo
Petco Pet Logo

Hill's Prescription Diet t/d Dental Care Chicken Flavor Dry Dog Food, 25 lbs.

Hill's Prescription Diet t/d Dental Care Chicken Flavor Dry Dog Food, 25 lbs.


Icon rx food 1
Veterinary Diet Item
This item requires veterinarian authorization
Icon info 2

This product requires veterinarian authorization. We’ll collect your pet and vet information to authorize this item before shipping.

Loading...
Weight
5 LB
$37.99
25 LBS
$116.84
Free Shipping $35+
Icon carat down

Description

Please note that the product information displayed is provided by manufacturers, suppliers and other third parties and is not independently verified by Petco.

Hill's Prescription Diet t/d Dry Dog Food is clinically proven to reduce plaque, stain & tartar buildup and clean up to the gum line. It works like a toothbrush, dental floss & mouthwash all in one. The kibble contains clinically proven triple action fiber matrix technology to remove plaque, stain & tartar buildup. The special matrix of fibers scrub the tooth to remove plaque which helps freshen breath and whiten teeth. The large kibble size, shape and texture cleans the teeth to the gum line to promote healthy gums and teeth. Exclusive feeding of Hill's Prescription Diet t/d Dog Dry Food has been shown to be more effective than toothbrushing. Hill's nutritionists & veterinarians developed Prescription Diet t/d clinical nutrition to promote healthy gums and teeth and support your dog's overall health. This food is accepted as the ONLY therapeutic nutrition for proven reduction in buildup of both plaque & tartar by Veterinary Oral Health Council (VOHC).

  • - Hill's Prescription Diet t/d Dental Care Chicken Flavor Dry Dog Food is specially formulated by Hill's nutritionists and veterinarians to support your dog's dental health
  • - Clinically proven nutrition to reduce plaque, stain and tartar buildup
  • - Unique kibble size, shape and texture cleans tooth surface up to the gum line
  • - Clinically proven triple action fiber matrix technology to help freshen breath, clean and whiten teeth and reduce plaque & tartar buildup
  • - Complete & balanced nutrition with clinically proven antioxidants to support your dog's daily health and immune system
  • - Hill's Prescription Diet is the #1 US Vet Recommended therapeutic pet food - consult with your vet to make sure Prescription Diet t/d is the right food for your dog

Specifications

SKU2190830
LifestageAdult
Primary BrandHill's Prescription Diet
Days to ShipShips Within 2-5 Business Days
Weight25 LBS

Additional Features

Grain FreeNo
Personalized Item flagYes
LifestageAdult

Pet Sizing

Breed SizesMost Sizes

Item Dimensions

Length15.748 IN
Height7.75 IN
Width23.622 IN

Ingredients

Brewers Rice, Whole Grain Corn, Chicken By-Product Meal, Powdered Cellulose, Chicken Fat, Soybean Mill Run, Egg Product, Hydrolyzed Chicken Flavor, Soybean Oil, Lactic Acid, Potassium Chloride, Calcium Sulfate, Iodized Salt, L-Lysine, vitamins (Vitamin ESupplement, L-Ascorbyl-2-Polyphosphate (source of Vitamin C), Niacin Supplement, Thiamine Mononitrate, Vitamin A Supplement, Calcium Pantothenate, Riboflavin Supplement, Biotin, Vitamin B12 Supplement, Pyridoxine Hydrochloride, Folic Acid, Vitamin D3 Supplement), Choline Chloride, DL-Methionine, minerals (Ferrous Sulfate, Zinc Oxide, Copper Sulfate, Manganous Oxide, Calcium Iodate, Sodium Selenite), Dicalcium Phosphate, Taurine, Mixed Tocopherols for freshness, Natural Flavors, Beta-Carotene.

Guaranteed Analysis

Protein: 18.3 %, Fat: 16.5 %, Carbohydrate / NFE: 49.9 %, Crude Fiber: 10.8 %, Calcium: 0.63 %, Phosphorus: 0.45 %, Potassium: 0.76 %, Sodium: 0.25 %, Magnesium: 0.081 %, Vitamin C: 190 ppm, Vitamin E: 746 IU/kg, Total Omega-3 FA: 0.24 %, Total Omega-6 FA: 3.83 %.

100% SATISFACTION GUARANTEED! Hill's is so confident that your pet will enjoy their foods, that they offer a 100% money-back guarantee. If you are unsatisfied for any reason, return the unused portion to the place of purchase for a full refund or replacement.

Please see package for complete feeding instructions. Adjust feeding amounts as necessary to maintain optimal weight. If you are unsure, ask your veterinarian. For best results & safety practices: gradually transition to your pets new food over a 7 day period. Exclusively feed the recommended Prescription Diet dry food, canned food & treats. Keep fresh water available at all times. Have your veterinarian monitor your pets condition.

Veterinarian authorized products ship only after Petco receives an authorization from your vet. We will not need to reach out to your vet or you if the authorization includes refills. When all available refills are used or the authorization expires, we will reach out to your vet to obtain a new authorization. For new authorizations, we will attempt to reach your vet for a total of 5 days. If your vet does not respond within 5 days, we will then reach out to you for a total of 3 days. If no response is given, the order will then be canceled.

These amounts are a starting point only and should be adjusted to maintain proper weight. These amounts are a starting point only and should be adjusted to maintain proper weight.

Deals That Sleigh. Spend $30+ Get An Extra $10 to use in store or online. Shopw Now. Ends 12/25/25. $10 off applies to a future purchase. Terms apply.

Reviews

Rating Snapshot

Select a row below to filter reviews.

5 stars

96

4 stars

15

3 stars

5

2 stars

2

1 stars

7

Overall Rating

4.5
79 out of 125 (63%) reviewers recommend this product

Review this Product

Adding a review will require a valid email for verification

Customer Images

Filter Reviews

Rating
1 - 8 of 94 Reviews
Most Recent

31 Ratings-Only Reviews

Rex loved it

Mad Jack

4 months ago
Great stuff, RexEnglish Mastiff loved it! Will buy again.

Originally posted on Hill's Pet Nutrition

Worst delivery ever

Upset

6 months ago
Horrible delivery, left dog food package out on the street in NYC

No, I do not recommend this product.

Helpful?

Great for large breed dogs and good for their teeth!

Newfie

1 year ago
I have a big, lovable Newfoundland dog. You know how huge they can be, right? He has a sensitive stomach and tends to get really bad diarrhea. One time, when we went to the vet for his vaccinations, they gave him these dental kibble as a treat in every room. He loves it! I bought a small bag because he's sensitive to changes in his food, but he loved them so much I ended up buying the biggest bag each time! He's been enjoying this for the past year. I also like to mix in different food toppers, like "real fresh food," to add some variety to his meals. It's good for him and helps keep his teeth healthy.

Originally posted on Hill's Pet Nutrition

Hill’s Products Are the Best

Dixielandbelle

1 year ago
My three rescued Boykins love this food, and it helps them maintain a healthy weight. The smaller kibble is easier for them to eat because they have missing teeth caused by neglect by their previous owners. We also use Hill’s Prescription Diet t/d as treats to help keep their remaining teeth healthy.

Yes, I recommend this product.

Helpful?

Si yfyxyfuguvihivifyeydidmhdkgditdfkciyftidkdhzg lhxxxhchcj kvyfgkvifyno fugugugug

Uzxu

1 year ago
Because the endure is differentnnnnvghvggujjkollokhgccstsydhfjjfgi

Originally posted on Hill's Pet Nutrition

Prescription Dog Food Order

Skbicycle

1 year ago
Had to upload my dogs prescription a second time two days after uploading it with the original order. Once uploaded a second time and with assistance from customer service my order was processed and received the food in a reasonable four days after.

Yes, I recommend this product.

Helpful?

Great product, easy process

J Cherbow

1 year ago
Excellent product, easy process and value pricing. Very happy

Yes, I recommend this product.

Helpful?

Dogs love it

Jen

2 years ago
Works great and the dogs love them. Just wish it came in another flavor for the pup who is allergic to chicken.

Originally posted on Hill's Pet Nutrition

Response from Hill's Pet Nutrition:
2 years ago
hillspetpwr
Thank you for your feedback. At this time, we do not offer other flavors of this product, however, we will be glad to make the suggestion for that product to the company on your behalf. Hill's Pet Nutrition
1 - 8 of 94 Reviews

Questions

1 - 2 of 2 Questions
Sort by: Newest Answers

What does the t/d stand for?

  1. I’m unsure but it may mean “tartar diet.”  Sorry, but I looked all over our bag of the Dental Care for dogs and it does not say anything about t/d.  I also checked the Hills Prescriprion Diet website but was unable to find any clarification of what t/d means.



do you need aprescription to buy the t/d dental treats

    Styled arrow button