Hill's Prescription Diet t/d Dental Care Chicken Flavor Dry Dog Food, 25 lbs.
Description
Hill's Prescription Diet t/d Dry Dog Food is clinically proven to reduce plaque, stain & tartar buildup and clean up to the gum line. It works like a toothbrush, dental floss & mouthwash all in one. The kibble contains clinically proven triple action fiber matrix technology to remove plaque, stain & tartar buildup. The special matrix of fibers scrub the tooth to remove plaque which helps freshen breath and whiten teeth. The large kibble size, shape and texture cleans the teeth to the gum line to promote healthy gums and teeth. Exclusive feeding of Hill's Prescription Diet t/d Dog Dry Food has been shown to be more effective than toothbrushing. Hill's nutritionists & veterinarians developed Prescription Diet t/d clinical nutrition to promote healthy gums and teeth and support your dog's overall health. This food is accepted as the ONLY therapeutic nutrition for proven reduction in buildup of both plaque & tartar by Veterinary Oral Health Council (VOHC).
- - Hill's Prescription Diet t/d Dental Care Chicken Flavor Dry Dog Food is specially formulated by Hill's nutritionists and veterinarians to support your dog's dental health
- - Clinically proven nutrition to reduce plaque, stain and tartar buildup
- - Unique kibble size, shape and texture cleans tooth surface up to the gum line
- - Clinically proven triple action fiber matrix technology to help freshen breath, clean and whiten teeth and reduce plaque & tartar buildup
- - Complete & balanced nutrition with clinically proven antioxidants to support your dog's daily health and immune system
- - Hill's Prescription Diet is the #1 US Vet Recommended therapeutic pet food - consult with your vet to make sure Prescription Diet t/d is the right food for your dog
Please note that the product information displayed is provided by manufacturers, suppliers and other third parties and is not independently verified by Petco.
Specifications
| SKU | 2190830 |
|---|---|
| Lifestage | Adult |
| Primary Brand | Hill's Prescription Diet |
| Days to Ship | Ships Within 2-5 Business Days |
| Weight | 25 LBS |
| Grain Free | No |
|---|---|
| Personalized Item flag | Yes |
| Lifestage | Adult |
| Length | 15.748 IN |
|---|---|
| Height | 7.75 IN |
| Width | 23.622 IN |
| Breed Sizes | Most Sizes |
|---|
Brewers Rice, Whole Grain Corn, Chicken By-Product Meal, Powdered Cellulose, Chicken Fat, Soybean Mill Run, Egg Product, Hydrolyzed Chicken Flavor, Soybean Oil, Lactic Acid, Potassium Chloride, Calcium Sulfate, Iodized Salt, L-Lysine, vitamins (Vitamin ESupplement, L-Ascorbyl-2-Polyphosphate (source of Vitamin C), Niacin Supplement, Thiamine Mononitrate, Vitamin A Supplement, Calcium Pantothenate, Riboflavin Supplement, Biotin, Vitamin B12 Supplement, Pyridoxine Hydrochloride, Folic Acid, Vitamin D3 Supplement), Choline Chloride, DL-Methionine, minerals (Ferrous Sulfate, Zinc Oxide, Copper Sulfate, Manganous Oxide, Calcium Iodate, Sodium Selenite), Dicalcium Phosphate, Taurine, Mixed Tocopherols for freshness, Natural Flavors, Beta-Carotene.
Protein: 18.3 %, Fat: 16.5 %, Carbohydrate / NFE: 49.9 %, Crude Fiber: 10.8 %, Calcium: 0.63 %, Phosphorus: 0.45 %, Potassium: 0.76 %, Sodium: 0.25 %, Magnesium: 0.081 %, Vitamin C: 190 ppm, Vitamin E: 746 IU/kg, Total Omega-3 FA: 0.24 %, Total Omega-6 FA: 3.83 %.
100% SATISFACTION GUARANTEED! Hill's is so confident that your pet will enjoy their foods, that they offer a 100% money-back guarantee. If you are unsatisfied for any reason, return the unused portion to the place of purchase for a full refund or replacement.
Please see package for complete feeding instructions. Adjust feeding amounts as necessary to maintain optimal weight. If you are unsure, ask your veterinarian. For best results & safety practices: gradually transition to your pets new food over a 7 day period. Exclusively feed the recommended Prescription Diet dry food, canned food & treats. Keep fresh water available at all times. Have your veterinarian monitor your pets condition.
Veterinarian authorized products ship only after Petco receives an authorization from your vet. We will not need to reach out to your vet or you if the authorization includes refills. When all available refills are used or the authorization expires, we will reach out to your vet to obtain a new authorization. For new authorizations, we will attempt to reach your vet for a total of 5 days. If your vet does not respond within 5 days, we will then reach out to you for a total of 3 days. If no response is given, the order will then be canceled.
These amounts are a starting point only and should be adjusted to maintain proper weight. These amounts are a starting point only and should be adjusted to maintain proper weight.
Reviews
Rating Snapshot
Review this Product
Customer Images
Filter Reviews
31 Ratings-Only Reviews
Bam Bam aka Bandit mom
Originally posted on Hill's Pet Nutrition
Rex loved it
Originally posted on Hill's Pet Nutrition
Worst delivery ever
No, I do not recommend this product.
Great for large breed dogs and good for their teeth!
Originally posted on Hill's Pet Nutrition
Hill’s Products Are the Best
Yes, I recommend this product.
Si yfyxyfuguvihivifyeydidmhdkgditdfkciyftidkdhzg lhxxxhchcj kvyfgkvifyno fugugugug
Originally posted on Hill's Pet Nutrition
Prescription Dog Food Order
Yes, I recommend this product.
Great product, easy process
Yes, I recommend this product.
Questions
What does the t/d stand for?
- I’m unsure but it may mean “tartar diet.” Sorry, but I looked all over our bag of the Dental Care for dogs and it does not say anything about t/d. I also checked the Hills Prescriprion Diet website but was unable to find any clarification of what t/d means.
Helpful?