Hill's Prescription Diet t/d Dental Care Chicken Flavor Dry Dog Food, 25 lbs.

Hill's Prescription Diet t/d Dental Care Chicken Flavor Dry Dog Food, 25 lbs. removed from the wishlist

Hill's Prescription Diet t/d Dental Care Chicken Flavor Dry Dog Food, 25 lbs.


Icon rx food 1
Veterinary Diet Item
This item requires veterinarian authorization
Icon info 2

This product requires veterinarian authorization. We’ll collect your pet and vet information to authorize this item before shipping.

Loading...




Free Shipping $35+
Icon carat down

Description

Please note that the product information displayed is provided by manufacturers, suppliers and other third parties and is not independently verified by Petco.

Hill's Prescription Diet t/d Dry Dog Food is clinically proven to reduce plaque, stain & tartar buildup and clean up to the gum line. It works like a toothbrush, dental floss & mouthwash all in one. The kibble contains clinically proven triple action fiber matrix technology to remove plaque, stain & tartar buildup. The special matrix of fibers scrub the tooth to remove plaque which helps freshen breath and whiten teeth. The large kibble size, shape and texture cleans the teeth to the gum line to promote healthy gums and teeth. Exclusive feeding of Hill's Prescription Diet t/d Dog Dry Food has been shown to be more effective than toothbrushing. Hill's nutritionists & veterinarians developed Prescription Diet t/d clinical nutrition to promote healthy gums and teeth and support your dog's overall health. This food is accepted as the ONLY therapeutic nutrition for proven reduction in buildup of both plaque & tartar by Veterinary Oral Health Council (VOHC).

  • - Hill's Prescription Diet t/d Dental Care Chicken Flavor Dry Dog Food is specially formulated by Hill's nutritionists and veterinarians to support your dog's dental health
  • - Clinically proven nutrition to reduce plaque, stain and tartar buildup
  • - Unique kibble size, shape and texture cleans tooth surface up to the gum line
  • - Clinically proven triple action fiber matrix technology to help freshen breath, clean and whiten teeth and reduce plaque & tartar buildup
  • - Complete & balanced nutrition with clinically proven antioxidants to support your dog's daily health and immune system
  • - Hill's Prescription Diet is the #1 US Vet Recommended therapeutic pet food - consult with your vet to make sure Prescription Diet t/d is the right food for your dog

Specifications

SKU2190830
LifestageAdult
Primary BrandHill's Prescription Diet
Days to ShipShips Within 2-5 Business Days
Weight25 LBS

Additional Features

Grain FreeNo
Personalized Item flagYes
LifestageAdult

Item Dimensions

Length15.748 IN
Height7.75 IN
Width23.622 IN

Pet Sizing

Breed SizesMost Sizes

Ingredients

Brewers Rice, Whole Grain Corn, Chicken By-Product Meal, Powdered Cellulose, Chicken Fat, Soybean Mill Run, Egg Product, Hydrolyzed Chicken Flavor, Soybean Oil, Lactic Acid, Potassium Chloride, Calcium Sulfate, Iodized Salt, L-Lysine, vitamins (Vitamin ESupplement, L-Ascorbyl-2-Polyphosphate (source of Vitamin C), Niacin Supplement, Thiamine Mononitrate, Vitamin A Supplement, Calcium Pantothenate, Riboflavin Supplement, Biotin, Vitamin B12 Supplement, Pyridoxine Hydrochloride, Folic Acid, Vitamin D3 Supplement), Choline Chloride, DL-Methionine, minerals (Ferrous Sulfate, Zinc Oxide, Copper Sulfate, Manganous Oxide, Calcium Iodate, Sodium Selenite), Dicalcium Phosphate, Taurine, Mixed Tocopherols for freshness, Natural Flavors, Beta-Carotene.

Guaranteed Analysis

Protein: 18.3 %, Fat: 16.5 %, Carbohydrate / NFE: 49.9 %, Crude Fiber: 10.8 %, Calcium: 0.63 %, Phosphorus: 0.45 %, Potassium: 0.76 %, Sodium: 0.25 %, Magnesium: 0.081 %, Vitamin C: 190 ppm, Vitamin E: 746 IU/kg, Total Omega-3 FA: 0.24 %, Total Omega-6 FA: 3.83 %.

100% SATISFACTION GUARANTEED! Hill's is so confident that your pet will enjoy their foods, that they offer a 100% money-back guarantee. If you are unsatisfied for any reason, return the unused portion to the place of purchase for a full refund or replacement.

Please see package for complete feeding instructions. Adjust feeding amounts as necessary to maintain optimal weight. If you are unsure, ask your veterinarian. For best results & safety practices: gradually transition to your pets new food over a 7 day period. Exclusively feed the recommended Prescription Diet dry food, canned food & treats. Keep fresh water available at all times. Have your veterinarian monitor your pets condition.

Veterinarian authorized products ship only after Petco receives an authorization from your vet. We will not need to reach out to your vet or you if the authorization includes refills. When all available refills are used or the authorization expires, we will reach out to your vet to obtain a new authorization. For new authorizations, we will attempt to reach your vet for a total of 5 days. If your vet does not respond within 5 days, we will then reach out to you for a total of 3 days. If no response is given, the order will then be canceled.

These amounts are a starting point only and should be adjusted to maintain proper weight. These amounts are a starting point only and should be adjusted to maintain proper weight.

35% OFF your 1st Repeat Delivery order

of select Royal Canin breed-specific recipes

Shop Now

Terms apply.

Reviews

Rating Snapshot

Select a row below to filter reviews.

5 stars

87

4 stars

13

3 stars

4

2 stars

2

1 stars

6

Overall Rating

4.5
74 out of 112 (66%) reviewers recommend this product

Review this Product

Adding a review will require a valid email for verification

Customer Images

Filter Reviews

Rating
1 - 8 of 88 Reviews
Most Recent

24 Ratings-Only Reviews

Great for large breed dogs and good for their teeth!

Newfie

6 months ago
I have a big, lovable Newfoundland dog. You know how huge they can be, right? He has a sensitive stomach and tends to get really bad diarrhea. One time, when we went to the vet for his vaccinations, they gave him these dental kibble as a treat in every room. He loves it! I bought a small bag because he's sensitive to changes in his food, but he loved them so much I ended up buying the biggest bag each time! He's been enjoying this for the past year. I also like to mix in different food toppers, like "real fresh food," to add some variety to his meals. It's good for him and helps keep his teeth healthy.
Originally posted on Hill's Pet Nutrition

Originally posted on Hill's Pet Nutrition

Si yfyxyfuguvihivifyeydidmhdkgditdfkciyftidkdhzg lhxxxhchcj kvyfgkvifyno fugugugug

Uzxu

9 months ago
Because the endure is differentnnnnvghvggujjkollokhgccstsydhfjjfgi
Originally posted on Hill's Pet Nutrition

Originally posted on Hill's Pet Nutrition

Dogs love it

Jen

1 year ago
Works great and the dogs love them. Just wish it came in another flavor for the pup who is allergic to chicken.
Originally posted on Hill's Pet Nutrition

Originally posted on Hill's Pet Nutrition

Response from Hill's Pet Nutrition:
1 year ago
hillspetpwr
Thank you for your feedback. At this time, we do not offer other flavors of this product, however, we will be glad to make the suggestion for that product to the company on your behalf. Hill's Pet Nutrition

No and my vet reccomended it

Ted

1 year ago
My lab just had dental work under anesthesia.The vet reccomended t/d.I wont buy it because usually my lab takes one crunch and down her throat it goes.Problem is you make it way to small.It needs to be big and long like a carrot.We give her a raw carrot a big one and she eats it by breaking pieces off.It lasts longer and gets crunched in her teeth.
Originally posted on Hill's Pet Nutrition

Originally posted on Hill's Pet Nutrition

Response from Hill's Pet Nutrition:
1 year ago
hillspetpwr
We appreciate your feedback. While we strive to create foods which will be palatable and acceptable to all pets, we recognize that not every product will match every pet's preferences. We would encourage you to discuss an alternative option with your trusted veterinarian.

Best "treats"

Suzanne

1 year ago
I give my Newfoundland these as "treats" and he loves them. Just the right size for a Newf. We have been doing this for about 5 years and he is still happy to get them. I can figure them into his kibble calorie measurement as we always watch his weight.
Originally posted on Hill's Pet Nutrition

Originally posted on Hill's Pet Nutrition

Great dog teeth cleaner

Loves Goldens

2 years ago
I give my hundred-pound golden retriever six large ones at bedtime. He is always excited about them. This saved him from needing an expensive dental cleaning
Originally posted on Hill's Pet Nutrition

Originally posted on Hill's Pet Nutrition

It's an Edible Toothbrush!

JosieLu

3 years ago
My sweet German Shorthaired Pointer had a cancerous (Osteosarcoma) tumor in her mouth. We had it removed and the UW-Dental Clinic highly recommended that we start feeding her the Hill's Prescription Diet t/d Dental Care Chicken formula. They explained that the larger chunks break in a specific and purposeful way so as to cleanse the teeth as the dog crunches down on them. It will help keep her teeth clean, in addition to us brushing her teeth daily. Our GSP absolutely LOVES them! We started using them as treats to see if she liked them. Now we mix it with her regular Hill's Science Diet food everyday. She literally picks out and eats the Dental chunks first before she eats the rest of her food. It's an expensive formula, but after what she's been through with having dental/cancer surgery, she can have whatever is BEST for her! Thank you for creating this formula!!

Yes, I recommend this product.

Helpful?

Clean teeth

Nean106

3 years ago
I use them as treat and he loves them. So far his teeth are doing good

Yes, I recommend this product.

Helpful?
1 - 8 of 88 Reviews

Questions

1 - 2 of 2 Questions
Sort by: Newest Answers

What does the t/d stand for?

  1. I’m unsure but it may mean “tartar diet.”  Sorry, but I looked all over our bag of the Dental Care for dogs and it does not say anything about t/d.  I also checked the Hills Prescriprion Diet website but was unable to find any clarification of what t/d means.



do you need aprescription to buy the t/d dental treats

    Styled arrow button