Two Easy Ways to Start Earning Rewards!
Become a member today!
Members-only pricing and offers, personalized care notifications, Vital Care points back on every purchase and more!
Become a credit card member today!Earn 2X Pals Rewards points at Petco
when you use Petco Pay!APPLY NOWLearn More About Petco Pay Benefits
Hill's Prescription Diet t/d Dental Care Chicken Flavor Dry Dog Food, 25 lbs.
Description
Please note that the product information displayed is provided by manufacturers, suppliers and other third parties and is not independently verified by Petco.
Hill's Prescription Diet t/d Dry Dog Food is clinically proven to reduce plaque, stain & tartar buildup and clean up to the gum line. It works like a toothbrush, dental floss & mouthwash all in one. The kibble contains clinically proven triple action fiber matrix technology to remove plaque, stain & tartar buildup. The special matrix of fibers scrub the tooth to remove plaque which helps freshen breath and whiten teeth. The large kibble size, shape and texture cleans the teeth to the gum line to promote healthy gums and teeth. Exclusive feeding of Hill's Prescription Diet t/d Dog Dry Food has been shown to be more effective than toothbrushing. Hill's nutritionists & veterinarians developed Prescription Diet t/d clinical nutrition to promote healthy gums and teeth and support your dog's overall health. This food is accepted as the ONLY therapeutic nutrition for proven reduction in buildup of both plaque & tartar by Veterinary Oral Health Council (VOHC).
- - Hill's Prescription Diet t/d Dental Care Chicken Flavor Dry Dog Food is specially formulated by Hill's nutritionists and veterinarians to support your dog's dental health
- - Clinically proven nutrition to reduce plaque, stain and tartar buildup
- - Unique kibble size, shape and texture cleans tooth surface up to the gum line
- - Clinically proven triple action fiber matrix technology to help freshen breath, clean and whiten teeth and reduce plaque & tartar buildup
- - Complete & balanced nutrition with clinically proven antioxidants to support your dog's daily health and immune system
- - Hill's Prescription Diet is the #1 US Vet Recommended therapeutic pet food - consult with your vet to make sure Prescription Diet t/d is the right food for your dog
Specifications
| SKU | 2190830 |
|---|---|
| Lifestage | Adult |
| Primary Brand | Hill's Prescription Diet |
| Days to Ship | Ships Within 2-5 Business Days |
| Weight | 25 LBS |
Additional Features
| Grain Free | No |
|---|---|
| Personalized Item flag | Yes |
| Lifestage | Adult |
Item Dimensions
| Length | 15.748 IN |
|---|---|
| Height | 7.75 IN |
| Width | 23.622 IN |
Pet Sizing
| Breed Sizes | Most Sizes |
|---|
Ingredients
Brewers Rice, Whole Grain Corn, Chicken By-Product Meal, Powdered Cellulose, Chicken Fat, Soybean Mill Run, Egg Product, Hydrolyzed Chicken Flavor, Soybean Oil, Lactic Acid, Potassium Chloride, Calcium Sulfate, Iodized Salt, L-Lysine, vitamins (Vitamin ESupplement, L-Ascorbyl-2-Polyphosphate (source of Vitamin C), Niacin Supplement, Thiamine Mononitrate, Vitamin A Supplement, Calcium Pantothenate, Riboflavin Supplement, Biotin, Vitamin B12 Supplement, Pyridoxine Hydrochloride, Folic Acid, Vitamin D3 Supplement), Choline Chloride, DL-Methionine, minerals (Ferrous Sulfate, Zinc Oxide, Copper Sulfate, Manganous Oxide, Calcium Iodate, Sodium Selenite), Dicalcium Phosphate, Taurine, Mixed Tocopherols for freshness, Natural Flavors, Beta-Carotene.
Guaranteed Analysis
Protein: 18.3 %, Fat: 16.5 %, Carbohydrate / NFE: 49.9 %, Crude Fiber: 10.8 %, Calcium: 0.63 %, Phosphorus: 0.45 %, Potassium: 0.76 %, Sodium: 0.25 %, Magnesium: 0.081 %, Vitamin C: 190 ppm, Vitamin E: 746 IU/kg, Total Omega-3 FA: 0.24 %, Total Omega-6 FA: 3.83 %.
100% SATISFACTION GUARANTEED! Hill's is so confident that your pet will enjoy their foods, that they offer a 100% money-back guarantee. If you are unsatisfied for any reason, return the unused portion to the place of purchase for a full refund or replacement.
Please see package for complete feeding instructions. Adjust feeding amounts as necessary to maintain optimal weight. If you are unsure, ask your veterinarian. For best results & safety practices: gradually transition to your pets new food over a 7 day period. Exclusively feed the recommended Prescription Diet dry food, canned food & treats. Keep fresh water available at all times. Have your veterinarian monitor your pets condition.
Veterinarian authorized products ship only after Petco receives an authorization from your vet. We will not need to reach out to your vet or you if the authorization includes refills. When all available refills are used or the authorization expires, we will reach out to your vet to obtain a new authorization. For new authorizations, we will attempt to reach your vet for a total of 5 days. If your vet does not respond within 5 days, we will then reach out to you for a total of 3 days. If no response is given, the order will then be canceled.
These amounts are a starting point only and should be adjusted to maintain proper weight. These amounts are a starting point only and should be adjusted to maintain proper weight.
Reviews
Rating Snapshot
Review this Product
Customer Images
Filter Reviews
29 Ratings-Only Reviews
Great for large breed dogs and good for their teeth!
Newfie
Originally posted on Hill's Pet Nutrition
Hill’s Products Are the Best
Dixielandbelle
Yes, I recommend this product.
Si yfyxyfuguvihivifyeydidmhdkgditdfkciyftidkdhzg lhxxxhchcj kvyfgkvifyno fugugugug
Uzxu
Originally posted on Hill's Pet Nutrition
Prescription Dog Food Order
Skbicycle
Yes, I recommend this product.
Great product, easy process
J Cherbow
Yes, I recommend this product.
Dogs love it
Jen
Originally posted on Hill's Pet Nutrition
No and my vet reccomended it
Ted
Originally posted on Hill's Pet Nutrition
Best "treats"
Suzanne
Originally posted on Hill's Pet Nutrition
Questions
What does the t/d stand for?
- I’m unsure but it may mean “tartar diet.” Sorry, but I looked all over our bag of the Dental Care for dogs and it does not say anything about t/d. I also checked the Hills Prescriprion Diet website but was unable to find any clarification of what t/d means.
Helpful?
do you need aprescription to buy the t/d dental treats
Hill's Healthy Advantage Puppy Large Breed
25 Lbs Dog Foods
24 Lbs Dog Foods
Dental Food For Dogs
Veterinary Diet Dog Food
Dog Food 40 Lbs
Dog Food For Tartar Control
15 Lbs Dog Foods
28 Lbs Dog Foods
Purina Pro Plan Pet Dental Chews
Dry Dog Food
Hill's Science Diet Turkey And Barley
5 Lbs Dog Foods
10 Lbs Dog Foods
18 Lbs Dog Foods
4.5 Lbs Dog Foods
Soft Dry Dog Food For Dogs With Bad Teeth
11 Lbs Dog Foods
Dog Food For Senior Dogs With Bad Teeth
Large Breed Wet Dog Food
Hill's Prescription Diet Dry Dog Food
Hill's Prescription Diet Veterinary Diet Dog Food
Hill's Prescription Diet Dog Food
Hill's Prescription Diet Wet Dog Food
Hill's Prescription Diet
Hill's Prescription Diet Weight Management Dog Food
Hill's Veterinary Diet Dog Food
Hill's Dry Dog Food
Hill's Prescription Diet Prescription Dog Treats
Hill's Prescription Diet Dog Food With Grain
Hill's Prescription Diet Dry Cat Food
Hill's Large Breed Dog Food
Hill's Prescription Diet Dog Treats & Chews
Hill's Prescription Diet Veterinary Diet Cat Food
Hill's Dog Food
Hill's Prescription Diet Cat Food
Hill's Small Breed Dog Food
Hill's Weight Management Dog Food
Hill's Prescription Diet Weight Management Cat Food
Hill's Prescription Diet Wet Cat Food
What would be the best wet dog food for her weighing 3.3 lbs. 4 years and has Periodontal desease? And can I purchase at Petco or Petsmart? Thank you
I currently feed my male dog prescription Hill's z/d dry dog food I get from his vet. My female dog, who is on a normal food diet and does not need z/d food, wants to eat only the male's z/d food. It is challenging keeping them separated at meal time. Is there a comparable non-prescription food I can feed my female from Hill's that I can buy from Petco at a (considerably) lower price than the z/d?
We have a 25 lb labradoodle that must eat hills prescription diet w/d. She has slowly gotten tired of the food and we have been adding bits of chicken and even hamburger to get her to eat. That has been successful but is now wearing off to the point where all she wants is the meat. Any suggestions as to how to entice her to eat? She is healthy otherwise.
On the Hills homepage they say that the Hills Prescription diet Derm Defense can be used long term. But my question is if I should use it long term. I jist want a food for my dog that will give her the healthiest life possible, I don't really care about the cost.
RE: DOG FOOD My dog is eating Hill's science diet 7+ Active Longevity Small Bites (chicken meal, rice & Barley recipe) for years. But I found out Hill's is recalling their dog foods recently and I am worrying the dog food my dog eating now also have the problems. Should I change other brands OR I cook chicken breast with carrot and broccoli for her instead? or other foods you recommend? She had pancreatitis 2 times and consulted the vet and was told she cannot eat too much oily food.
Hi how would you compare blue buffalo Rx diet HF hydrolyzed canned food to hills Z/d hydrolyzed rx canned diet? Trying to find an alternative to royal Canin Selected protein Rx diets which Trixie will no longer eat .. nor does she like the hills z/d. Thanks
I recently asked how I can help Minnie loose weight because she is 13 pounds, and my response was to put her on a Science Diet metabolic weight management diet. My responder said it had good outcomes with his previous patients, but was he talking about the Hill’s Prescription Diet Metabolic Weight Management Dog Food? And if it is, is there a specific flavor that is best to use for her weight loss plan? Also, I live in Arizona — with terrible heat. I was told to walk her 3-4 times a day. Can I?
Hi! Tony has been eating wet/canned royal canin aging 12+ , he’s 18 years old , and I wanted an opinion on this food as far as senior diets go. My vet had me try rx veterinary hills g/d canned food but he didn’t like it. is the aging 12+ a good senior diet option for a food lower in phosphorus and sodium? Thx!
Our 1 1/2 year old female ragdoll feline started loosing patches of fur for last 2 weeks. No scabs/raw spots on skin. Vetinarian concludes not fleas or ringworm. No known environmental changes or new house products. Now starting Royal Canin Hydrolyzed Protein Adult HP for 2-3 weeks in case it's food allergies. It's $50 for 7.7 lbs. Is there a less expensive equivalent Purina or other brand?? Thanks from Florida.
My dog weight 27 pounds what is the best diet to put her on for couple weeks she is only 3 years old
The vet prescribed Duke Hills weight loss and mobility food because he is significantly overweight (10 year old chihuahua pug mix) I know I’m supposed to feed an amount of food based on his ideal weight but the vet didn’t tell me how much he should weigh.
What’s the difference between chicken and rice dry dog food Vs lamb and rice dry dog food? Which is the recommended choice? My puppy eats Hills science diet.